SEC24B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEC24B Polyclonal antibody, PBS Only (32225-1-PBS)

• 

  WB analysis using 32225-1-AP (same clone as 32225-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32225-1-AP (SEC24B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32225-1-PBS in a different storage buffer formulation.

SEC24B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32225-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

SEC24-related protein B, Protein transport protein Sec24B

---

Product Information

32225-1-PBS targets SEC24B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36544

  Product name: Recombinant human SEC24B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-250 aa of NM_006323.4

  Sequence: QNVTPNTVNQQPGAQQLYSRGPPAPHIVGSTLGSFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVRPVKDNSFSGQNTAISHPSPLPPLPSQQHHQ

• Full Name: SEC24 family, member B (S. cerevisiae)
• Calculated Molecular Weight: 137kDa，1268aa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: NM_006323.4
• Gene Symbol: SEC24B
• Gene ID (NCBI): 10427
• RRID: AB_3742547
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95487
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SEC24B is a gene that encodes a protein belonging to the SEC23/SEC24 family, which is involved in vesicle trafficking. The protein is thought to be a cargo-binding component of the COPII vesicle and is involved in the transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.