• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated SECISBP2 Polyclonal antibody

SECISBP2 Polyclonal Antibody for IF/ICC
Cat No. CL488-12798

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

DKFZp686C09169, SBP2, SECIS binding protein 2, SECISBP2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12798 targets SECISBP2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3541

Product name: Recombinant human SECISBP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 506-854 aa of BC036109

Sequence: NPLDSSAPLMKKGKQREIPKAKKPTSLKKIILKERQERKQRLQENAVGPAFTSDDTQDGESGGDDQFPEQAELSGPEGMDELISTPSVEDKSEEPPGTELQRDTEASHLAPNHTTFPKIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEESLEASTSQMMNLNL

Predict reactive species
Full Name SECIS binding protein 2
Calculated Molecular Weight 854 aa, 95 kDa
Observed Molecular Weight 95 kDa
GenBank Accession NumberBC036109
Gene Symbol SECISBP2
Gene ID (NCBI) 79048
RRIDAB_3672551
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96T21
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Selenium (Se) is an essential trace element required for the biosynthesis of selenoproteins, and selenocysteine insertion sequence (SECIS) binding protein 2 (SECISBP2, or SBP2) represents a key trans-acting factor for the cotranslational insertion of selenocysteine into selenoproteins. Defects in SBP2 are a cause of abnormal thyroid hormone metabolism (ATHYHM) associated with a reduction in type II iodothyronine deiodinase activity. Mutations in this gene have been associated with a reduction in activity of a specific thyroxine deiodinase, a selenocysteine-containing enzyme, and abnormal thyroid hormone metabolism. Cells depleted of SBP2 have increased levels of ROS, which lead to cellular oxidative stress manifested as DNA lesions, stress granules, and lipid peroxidation, induction of caspase- and cytochrome c-dependent apoptosis, indicating that SBP2 is required for protection against ROS-induced cellular damage and cell survival.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SECISBP2 antibody CL488-12798Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...