SELENOO Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SELENOO Polyclonal antibody, PBS Only (32860-1-PBS)

• 

  WB analysis using 32860-1-AP (same clone as 32860-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32860-1-AP (RP3-402G11.5 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32860-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 32860-1-AP (same clone as 32860-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 32860-1-AP (SELENOO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32860-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 32860-1-AP (same clone as 32860-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 32860-1-AP (SELENOO antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32860-1-PBS in a different storage buffer formulation.

SELENOO Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 32860-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.7.7.108, Protein adenylyltransferase SelO, mitochondrial, Selenoprotein O, SelO

---

Product Information

32860-1-PBS targets SELENOO in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35939

  Product name: Recombinant human RP3-402G11.5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 477-666 aa of BC110866

  Sequence: LARLMEQCASLEELRLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLEQLSAAELQSRNQGHWADWLQAYRARLDKDLEGAGDAAAWQAEHVRVMHANNPKYVLRNYIAQNAIEAAERGDFSEVRRVLKLLETPYHCEAGAATDAEATEADGADGRQRSYSSKPPLWAAELCVT

• Full Name: selenoprotein O
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC110866
• Gene Symbol: RP3-402G11.5
• Gene ID (NCBI): 83642
• RRID: AB_3742767
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BVL4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SELENOO (Selenoprotein O) is a selenocysteine-containing (Sec) selenoprotein belonging to the oxidoreductase family, which is mainly localized in the endoplasmic reticulum (ER) membranes with multiple transmembrane structural domains. SELENOO plays important roles in a variety of cellular processes, including redox homeostasis and lipid metabolism and DNA damage repair. It plays an important role in a variety of cellular processes, including redox homeostasis, lipid metabolism, and DNA damage repair. SELENOO is aberrantly expressed in a variety of diseases, including cancer and neurodegenerative diseases. For example, in melanoma and lung cancer, the upregulation of SELENOO expression is associated with tumor progression and metastasis, which has become a hot topic in current research.