SELS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SELS Polyclonal antibody, PBS Only (15591-1-PBS)

• 

  WB analysis of rat brain using 15591-1-AP (same clone as 15591-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 15591-1-AP (SELS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15591-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15591-1-AP (same clone as 15591-1-PBS)

  WB result of SELS antibody (15591-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SELS transfected HeLa cells. This data was developed using the same antibody clone with 15591-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 15591-1-AP (same clone as 15591-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15591-1-AP (SELS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15591-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 15591-1-AP (same clone as 15591-1-PBS)

  IP result of anti-SELS (IP:15591-1-AP, 3ug; Detection:15591-1-AP 1:500) with HepG2 cells lysate 600ug. This data was developed using the same antibody clone with 15591-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 15591-1-AP (same clone as 15591-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 15591-1-AP (SELS antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15591-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 15591-1-AP (same clone as 15591-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 15591-1-AP (SELS antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15591-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SELS Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15591-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

SEPS1, SELENOS, Selenoprotein S, SBBI8, ADO15

---

Product Information

15591-1-PBS targets SELS in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7928

  Product name: Recombinant human SELS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC005840

  Sequence: MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

• Full Name: selenoprotein S
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC005840
• Gene Symbol: SELS
• Gene ID (NCBI): 55829
• RRID: AB_2263813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQE4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SELS, also named as VIMP and SEPS1, plays an important role in the production of inflammatory cytokines and its expression is activated by endoplasmic reticulum (ER) stress. It probably acts by serving as a linker between DERL1 and VCP.