SENP3 Recombinant monoclonal antibody, PBS Only (Capture)

SENP3 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85837-3-PBS
Clone No.250153A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

EC:3.4.22.-, Sentrin/SUMO-specific protease SENP3, Sentrin-specific protease 3, SMT3IP1, SSP3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85837-3-PBS targets SENP3 as part of a matched antibody pair:

MP02141-1: 85837-3-PBS capture and 85837-1-PBS detection (validated in Cytometric bead array)

MP02141-2: 85837-3-PBS capture and 85837-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11911

Product name: Recombinant human SENP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 225-574 aa of BC080658

Sequence: GLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV

Predict reactive species
Full Name SUMO1/sentrin/SMT3 specific peptidase 3
Calculated Molecular Weight 574 aa, 65 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC080658
Gene Symbol SENP3
Gene ID (NCBI) 26168
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H4L4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SENP3(Sentrin-specific protease 3) is also named as SSP3, SUSP3 and belongs to the peptidase C48 family. It acts as an essential factor for ribosome biogenesis. SENP3 might regulate the sumoylation of other substrates through directly binding or mediating association with NPM1 at the nucleolus and other subcellular compartments.

Loading...
||
New chat Able
正在加载,请稍候...