CoraLite® Plus 488-conjugated SENP3 Recombinant monoclonal antibody

• 

  IF Staining of MCF-7 using CL488-85837-3

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite® Plus 488 SENP3 antibody (CL488-85837-3, Clone: 250153A9 ) at dilution of 1:200, CL594-Phalloidin (red).

SENP3 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85837-3

Clone No.250153A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

EC:3.4.22.-, Sentrin/SUMO-specific protease SENP3, Sentrin-specific protease 3, SMT3IP1, SSP3

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85837-3 targets SENP3 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11911

  Product name: Recombinant human SENP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 225-574 aa of BC080658

  Sequence: GLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV

• Full Name: SUMO1/sentrin/SMT3 specific peptidase 3
• Calculated Molecular Weight: 574 aa, 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC080658
• Gene Symbol: SENP3
• Gene ID (NCBI): 26168
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H4L4
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SENP3(Sentrin-specific protease 3) is also named as SSP3, SUSP3 and belongs to the peptidase C48 family. It acts as an essential factor for ribosome biogenesis. SENP3 might regulate the sumoylation of other substrates through directly binding or mediating association with NPM1 at the nucleolus and other subcellular compartments.