CoraLite®594-conjugated SF3B3 Polyclonal antibody

SF3B3 Polyclonal Antibody for IF-P
Cat No. CL594-14577

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

KIAA0017, RSE1, SAP 130, SAP130, SF3b130, SF3B3, Splicing factor 3B subunit 3, STAF130

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-14577 targets SF3B3 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5980

Product name: Recombinant human SF3B3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-399 aa of BC003146

Sequence: EDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Predict reactive species
Full Name splicing factor 3b, subunit 3, 130kDa
Calculated Molecular Weight 136 kDa
Observed Molecular Weight130-135 kDa
GenBank Accession NumberBC003146
Gene Symbol SF3B3
Gene ID (NCBI) 23450
RRIDAB_3084641
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15393
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Introns are removed from nuclear pre-mRNA in 2-step transesterification reactions. Splicing occured in a large ribonucleoprotein particle, called the spliceosome. Spliceosomal intermediate complexes form on pre-mRNA in the order E, A, B, and C, with the catalytic reactions occurring in complex C. U2 small nuclear ribonucleoproteins are one of the proteins essential for spliceosome assembly and mRNA splicing. Functional U2 snRNP is composed of a 12S unit and 2 splicing factors, SF3A, which is composed of 3 proteins, and SF3B, which conposed of 4 proteins. SF3B3 is one of SF3B, and it's required for 'A' complex assembly formed by the stable binding of U2 snRNP to the brachpoint sequence(BPS) in pre-mRNA.

Protocols

Product Specific Protocols
IF protocol for CL594 SF3B3 antibody CL594-14577Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...