SFT2D2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SFT2D2 Polyclonal antibody, PBS Only (32914-1-PBS)

• 

  WB analysis using 32914-1-AP (same clone as 32914-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32914-1-AP (SFT2D2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32914-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 32914-1-AP (same clone as 32914-1-PBS)

  IP result of anti-SFT2D2 (IP:32914-1-AP, 4ug; Detection:32914-1-AP 1:500) with HeLa cells lysate 960 ug. This data was developed using the same antibody clone with 32914-1-PBS in a different storage buffer formulation.

SFT2D2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 32914-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

SFT2 domain-containing protein 2, UNQ512/PRO1027, Vesicle transport protein SFT2B

---

Product Information

32914-1-PBS targets SFT2D2 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36996

  Product name: Recombinant human SFT2D2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-63 aa of BC068098

  Sequence: MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRKGLH

• Full Name: SFT2 domain containing 2
• Calculated Molecular Weight: 160 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC068098
• Gene Symbol: SFT2D2
• Gene ID (NCBI): 375035
• RRID: AB_3742784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95562
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SFT2D2 is part of the SFT2 protein family, which is involved in managing membrane traffic inside cells. Its specific molecular role is linked to the Golgi apparatus, a central hub for processing and sorting proteins.