SGK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SGK2 Polyclonal antibody, PBS Only (11185-1-PBS)

• 

  WB analysis of human placenta using 11185-1-AP (same clone as 11185-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11185-1-AP (SGK2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11185-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 11185-1-AP (same clone as 11185-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 11185-1-AP (SGK2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11185-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11185-1-AP (same clone as 11185-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11185-1-AP (SGK2 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 11185-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11185-1-AP (same clone as 11185-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11185-1-AP (SGK2 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 11185-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SGK2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11185-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.7.11.1, H SGK2, Serine/threonine-protein kinase Sgk2, Serum/glucocorticoid-regulated kinase 2

---

Product Information

11185-1-PBS targets SGK2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1669

  Product name: Recombinant human SGK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-396 aa of BC014037

  Sequence: EEGRAVHGAAPQDLSRNLEFSELPDHCYRMNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC

• Full Name: serum/glucocorticoid regulated kinase 2
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 41-48 kDa
• GenBank Accession Number: BC014037
• Gene Symbol: SGK2
• Gene ID (NCBI): 10110
• RRID: AB_2188525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBY8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.