CoraLite®594-conjugated SH2D1B Polyclonal antibody

SH2D1B Polyclonal Antibody for FC (Intra)
Cat No. CL594-11871

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

EAT 2, EAT2, EAT-2, EWS/FLI1-activated transcript 2, SH2 domain containing 1B

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-11871 targets SH2D1B in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2454

Product name: Recombinant human SH2D1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-132 aa of BC022407

Sequence: MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP

Predict reactive species
Full Name SH2 domain containing 1B
Calculated Molecular Weight 132 aa, 15 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC022407
Gene Symbol SH2D1B
Gene ID (NCBI) 117157
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14796
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SH2D1B, also named as EAT2, an adaptor expressed in innate immune cells, including natural killer (NK) cells. It plays a role in controlling signal transduction through at least four receptors, CD84, SLAMF1, LY9 and CD244, expressed on the surface of professional antigen-presenting cells. EAT-2 overexpression would enhance the innate immune responses and also result in more potent Carcinoembryonic antigen-specific adaptive immune responses.

Protocols

Product Specific Protocols
FC protocol for CL594 SH2D1B antibody CL594-11871Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...