SHBG Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of human placenta using 83096-1-RR (same clone as 83096-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 83096-1-RR (SHBG antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83096-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83096-1-RR (same clone as 83096-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug SHBG Recombinant antibody (83096-1-RR, Clone:230356F10) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83096-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP80006-1

  Cytometric bead array standard curve of MP80006-1, SHBG Hybrid Matched Antibody Pair, PBS Only. Capture antibody: 68835-1-PBS. Detection antibody: 83096-1-PBS. Standard: Eg0369. Range: 0.625-80 ng/mL.

• 

  Affinity and Kinetic Characterization of 83096-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83096-1-RR against Human SHBG were performed. The affinity constant is 0.38 nM.

SHBG Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83096-1-PBS

Clone No.230356F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

230356F10, SBP, Sex hormone-binding globulin, Sex steroid binding protein, Sex steroid-binding protein

---

Product Information

83096-1-PBS targets SHBG as part of a matched antibody pair:

MP80006-1: 68835-1-PBS capture and 83096-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0369

  Product name: Recombinant Human SHBG protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 30-402 aa of BC101785

  Sequence: LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

• Full Name: sex hormone-binding globulin
• Calculated Molecular Weight: 402 aa, 44 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC101785
• Gene Symbol: SHBG
• Gene ID (NCBI): 6462
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04278
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SHBG (sex hormone-binding globulin), also known as androgen-binding protein (ABP), is the specific transport protein for sex steroid hormones in humans. SHBG is synthesized mainly by the liver and circulates in the blood, in form of homodimer with a single steroid-binding site per dimer. In addition to the plasma SHBG, a testis isoform expressed by Sortoli cells also exists due to the gene alternative splicing. Various bands (44-56 kDa) recognized by this antibody may represent variably glycosylated or different isoforms of SHBG.