SHBG Recombinant monoclonal antibody, PBS Only (Detector)

SHBG Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83096-1-PBS
Clone No.230356F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

230356F10, SBP, Sex hormone-binding globulin, Sex steroid binding protein, Sex steroid-binding protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83096-1-PBS targets SHBG as part of a matched antibody pair:

MP80006-1: 68835-1-PBS capture and 83096-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0369

Product name: Recombinant Human SHBG protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 30-402 aa of BC101785

Sequence: LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

Predict reactive species
Full Name sex hormone-binding globulin
Calculated Molecular Weight 402 aa, 44 kDa
Observed Molecular Weight40-50 kDa
GenBank Accession NumberBC101785
Gene Symbol SHBG
Gene ID (NCBI) 6462
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04278
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SHBG (sex hormone-binding globulin), also known as androgen-binding protein (ABP), is the specific transport protein for sex steroid hormones in humans. SHBG is synthesized mainly by the liver and circulates in the blood, in form of homodimer with a single steroid-binding site per dimer. In addition to the plasma SHBG, a testis isoform expressed by Sortoli cells also exists due to the gene alternative splicing. Various bands (44-56 kDa) recognized by this antibody may represent variably glycosylated or different isoforms of SHBG.

Loading...
||
New chat

Able

正在加载,请稍候...