SHBG Recombinant monoclonal antibody

SHBG Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83096-1-RR
Clone No.230356F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

230356F10, SBP, Sex hormone-binding globulin, Sex steroid binding protein, Sex steroid-binding protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83096-1-RR targets SHBG in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0369

Product name: Recombinant Human SHBG protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 30-402 aa of BC101785

Sequence: LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

Predict reactive species
Full Name sex hormone-binding globulin
Calculated Molecular Weight 402 aa, 44 kDa
Observed Molecular Weight40-50 kDa
GenBank Accession NumberBC101785
Gene Symbol SHBG
Gene ID (NCBI) 6462
RRIDAB_3670810
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04278
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SHBG (sex hormone-binding globulin), also known as androgen-binding protein (ABP), is the specific transport protein for sex steroid hormones in humans. SHBG is synthesized mainly by the liver and circulates in the blood, in form of homodimer with a single steroid-binding site per dimer. In addition to the plasma SHBG, a testis isoform expressed by Sortoli cells also exists due to the gene alternative splicing. Various bands (44-56 kDa) recognized by this antibody may represent variably glycosylated or different isoforms of SHBG.

Protocols

Product Specific Protocols
FC protocol for SHBG antibody 83096-1-RRDownload protocol
WB protocol for SHBG antibody 83096-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...