SIPA1L3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SIPA1L3 Polyclonal antibody, PBS Only (30544-1-PBS)

• 

  WB analysis using 30544-1-AP (same clone as 30544-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30544-1-AP (SIPA1L3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30544-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30544-1-AP (same clone as 30544-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30544-1-AP (SIPA1L3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30544-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 30544-1-AP (same clone as 30544-1-PBS)

  IP result of anti-SIPA1L3 (IP:30544-1-AP, 4ug; Detection:30544-1-AP 1:3000) with HeLa cells lysate 1320 ug. This data was developed using the same antibody clone with 30544-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 30544-1-AP (same clone as 30544-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30544-1-AP (SIPA1L3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30544-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30544-1-AP (same clone as 30544-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SIPA1L3 antibody (30544-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30544-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 30544-1-AP (same clone as 30544-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using SIPA1L3 antibody (30544-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30544-1-PBS in a different storage buffer formulation.

SIPA1L3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 30544-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

SPA-1-like protein 3, SPA 1 like protein 3, SIPA1-like protein 3, SIPA1 like protein 3, Signal-induced proliferation-associated 1-like protein 3

---

Product Information

30544-1-PBS targets SIPA1L3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30750

  Product name: Recombinant human SIPA1L3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC150620

  Sequence: MTTYRAIPSDGVDLAASCGARVGDVLPGPHTGDYAPLGFWAQNGSMSQPLGESPATATATATATTRPSPTTPAMPKMGVRARVADWPPKREALREHSNPSPSQDTDGTKATKMAHSMRSIQNGQPPTSTPASSGSKAFHRLSRRRSKDVEFQDGWPRSPGRAFLPLRHRSSSEITLSECDAEDAGEPRGARHTGALPLFREYGSTSSIDVQGMPEQSFFDILNEFRSEQPDARGCQALTELLRADPGPHLMGGGGGAKGDSHNGQPAKDSLLPLQPTKEKEKARKKPARGLGGGDTVDSS

• Full Name: signal-induced proliferation-associated 1 like 3
• Observed Molecular Weight: 195 kDa
• GenBank Accession Number: BC150620
• Gene Symbol: SIPA1L3
• Gene ID (NCBI): 23094
• RRID: AB_3086357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60292
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STEAP3 (Signal-induced proliferation-associated 1-like protein 3) is also named as KIAA0545 and SPAL3. STEAP3 is a member of the STEAP family and is composed of a six-transmembrane domain at the COOH-terminal domain and a cytoplasmic N-terminal oxidoreductase domain, which is essential for iron and copper uptake (PMID:16227996). STEAP3 contains a functional p53-binding site in its promoter and can be upregulated following p53 activation to enhance cell death in myeloid leukemia cell line and breast cancer cells (PMID: 18617898). By interacting with Nix, a pro-apoptotic Bcl-2 family member, and Myt1 kinase, a negative regulator of the G2/M transition, STEAP3 overexpression promotes apoptosis and inhibits G2/M transition in cell cycle progression (PMID: 12606722, PMID: 10504341).