CoraLite®700 Anti-Mouse SIRP Alpha/CD172a Rabbit Recombinant Antibody

• 

  FC experiment of mouse bone marrow cells using CL700-98225

  1x10^6 mouse bone marrow cells were surface stained with CoraLite® Plus 488 Anti-Mouse CD11b (M1/70) (CL488-65055, Clone: M1/70), and 0.25 ug CoraLite®700 Anti-Mouse SIRP Alpha/CD172a Rabbit RecAb (CL700-98225, Clone: 241794D9) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9). Cells were not fixed.

• 

  FC experiment of mouse bone marrow cells using CL700-98225

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug CoraLite®700 Anti-Mouse SIRP Alpha/CD172a Rabbit RecAb (CL700-98225, Clone: 241794D9) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were not fixed.

SIRP Alpha/CD172a Uni-rAb^® Recombinant Antibody for FC

Cat No. CL700-98225

Clone No.241794D9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241794D9, Bit, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a

---

Tested Applications

• Positive FC detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL700-98225 targets SIRP Alpha/CD172a in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1520

  Product name: Recombinant Mouse SIRP alpha/CD172a protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 32-373 aa of NM_007547.4

  Sequence: KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN

• Full Name: signal-regulatory protein alpha
• Calculated Molecular Weight: 56 kDa
• GenBank Accession Number: NM_007547.4
• Gene Symbol: Sirpa
• Gene ID (NCBI): 19261
• Conjugate: CoraLite®700 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 702 nm / 723 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P97797-2
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

SIRP Alpha, also known as CD172a, SHPS-1, and BIT, belongs to the SIRP family. SIRP Alpha is a transmembrane glycoprotein expressed explicitly on myeloid cells and provides a "do not eat me" signal after engaging with integrin-associated protein CD47 on tumor cells (PMID: 36419386). SIRP Alpha shows heterogeneity in molecular weight (~65-120 kDa) in various tissues due to differential glycosylation (PMID: 18051954).