SIRP beta 1/CD172b Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SIRP beta 1/CD172b Polyclonal antibody, PBS Only (11811-1-PBS)

• 

  WB analysis using 11811-1-AP (same clone as 11811-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 11811-1-AP (SIRP BETA 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11811-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 11811-1-AP (same clone as 11811-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 11811-1-AP (SIRP BETA 1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11811-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 11811-1-AP (same clone as 11811-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11811-1-AP (SIRP BETA 1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11811-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 11811-1-AP (same clone as 11811-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 11811-1-AP (SIRP BETA 1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11811-1-PBS in a different storage buffer formulation.

SIRP beta 1/CD172b Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11811-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

SIRPB1, SIRP BETA 1, SIRP-beta-1, Signal-regulatory protein beta-1, CD172b

---

Product Information

11811-1-PBS targets SIRP beta 1/CD172b in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2478

  Product name: Recombinant human SIRPB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC025286

  Sequence: MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA

• Full Name: signal-regulatory protein beta 1
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC025286
• Gene Symbol: SIRPB1
• Gene ID (NCBI): 10326
• RRID: AB_2188197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00241
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SIRP Beta 1 is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are cell surface signaling receptors differentially expressed in leukocytes and the central nervous system. SIRP Beta 1 interacts with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. SIRP Beta 1 also participates in the recruitment of tyrosine kinase SYK.