SKAP2 Monoclonal antibody

• 

  WB analysis of RAW 264.7 using 66367-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66367-1-Ig (SKAP2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 66367-1-Ig

  human spleen tissue were subjected to SDS PAGE followed by western blot with 66367-1-Ig (SKAP2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig liver using 66367-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 66367-1-Ig (SKAP2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 66367-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66367-1-Ig (SKAP2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66367-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66367-1-Ig (SKAP2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of NIH/3T3 using 66367-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using SKAP2 antibody (66367-1-Ig, Clone: 2G3G9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red).

SKAP2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66367-1-Ig

Clone No.2G3G9

Host / Isotype

Mouse / IgG1

Reactivity

human, pig, rat, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PRAP, Pyk2/RAFTK associated protein, RA70, SAPS, SCAP2, SKAP 55HOM, SKAP HOM, SKAP2, SKAP55 homolog, SKAP55R

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, human spleen tissue, pig liver tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66367-1-Ig targets SKAP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig, rat, mouse samples.

• Tested Reactivity: human, pig, rat, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3615

  Product name: Recombinant human SKAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-359 aa of BC036044

  Sequence: MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI

• Full Name: src kinase associated phosphoprotein 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC036044
• Gene Symbol: SKAP2
• Gene ID (NCBI): 8935
• RRID: AB_2881747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75563
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SKAP2 (src kinase associated phosphoprotein 2), also named PRAP, contains PH domain and SH3 domain. It is localized in cytoplasm and was expressed in ubiquitously in various tissues including lung, skeletal muscle, and spleen, but not detectable in thymus and T cell lymphoma cells. SKAP2 may negatively regulate alpha-synuclein phosphorylation following cell stress. SKAP2 may be involved in B-cell and macrophage adhesion processes by coupling the B-cell receptor (BCR) to integrin activation.