CoraLite® Plus 488-conjugated SKAP2 Monoclonal antibody

SKAP2 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-66367
Clone No.2G3G9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

Retinoic acid-induced protein 70, RA70, Pyk2/RAFTK-associated protein, Pyk2/RAFTK associated protein, PRAP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66367 targets SKAP2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3615

Product name: Recombinant human SKAP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-359 aa of BC036044

Sequence: MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI

Predict reactive species
Full Name src kinase associated phosphoprotein 2
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC036044
Gene Symbol SKAP2
Gene ID (NCBI) 8935
RRIDAB_3084239
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75563
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SKAP2 (src kinase associated phosphoprotein 2), also named PRAP, contains PH domain and SH3 domain. It is localized in cytoplasm and was expressed in ubiquitously in various tissues including lung, skeletal muscle, and spleen, but not detectable in thymus and T cell lymphoma cells. SKAP2 may negatively regulate alpha-synuclein phosphorylation following cell stress. SKAP2 may be involved in B-cell and macrophage adhesion processes by coupling the B-cell receptor (BCR) to integrin activation.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SKAP2 antibody CL488-66367Download protocol
FC protocol for CL Plus 488 SKAP2 antibody CL488-66367Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...