CoraLite® Plus 488-conjugated SKP1 Monoclonal antibody

• 

  IF Staining of MCF-7 using CL488-67745

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CoraLite® Plus 488 SKP1 antibody (CL488-67745, Clone: 1D5G4 ) at dilution of 1:200.

SKP1 Monoclonal Antibody for IF/ICC

Cat No. CL488-67745

Clone No.1D5G4

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF/ICC

Synonyms

EMC19, OCP 2, OCP II, OCP2, Organ of Corti protein 2, Organ of Corti protein II, p19A, p19skp1, SIII, SKP1, SKP1A, TCEB1L

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67745 targets SKP1 in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30709

  Product name: Recombinant human SKP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC009839

  Sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

• Full Name: S-phase kinase-associated protein 1
• Calculated Molecular Weight: 19 kDa
• GenBank Accession Number: BC009839
• Gene Symbol: SKP1
• Gene ID (NCBI): 6500
• RRID: AB_2923786
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63208
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SKP1(S-phase kinase-associated protein 1) is also named as EMC19, OCP2, SKP1A, TCEB1L,belongs to the SKP1 family.It is an essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription.