SKP2 Recombinant monoclonal antibody

• 

  WB analysis using 85670-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85670-4-RR (SKP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 85670-4-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85670-4-RR (SKP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 85670-4-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SKP2 antibody (85670-4-RR, Clone: 243080H6 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 85670-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85670-4-RR against Human SKP2 were performed. The affinity constant is 0.317 nM.

SKP2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85670-4-RR

Clone No.243080H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Cyclin-A/CDK2-associated protein p45, F box protein Skp2, F box/LRR repeat protein 1, FBL1, F-box protein Skp2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85670-4-RR targets SKP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6826

  Product name: Recombinant human SKP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-344 aa of BC001441

  Sequence: MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSR

• Full Name: S-phase kinase-associated protein 2 (p45)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa, 46 kDa
• GenBank Accession Number: BC001441
• Gene Symbol: SKP2
• Gene ID (NCBI): 6502
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13309
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SKP2(S-phase kinase-associated protein 2) is also named as FBXL1 and belongs to the F-box family. It regulates cellular proliferation by targeting several cell cycle-regulated proteins for ubiquitination and degradation, including cyclin-dependent kinase inhibitor CDKN1B(PMID:22200179). The acetylation of SKP2 in the nuclear localization signal (NLS) can promote its cytoplasmic retention, and cytoplasmic SKP2 enhances cellular migration through ubiquitination and destruction of CDH. This protein has 3 isoforms produced by alternative splicing (PMID:26497688, PMID:16902410).