CoraLite® Plus 488-conjugated SKP2 Recombinant monoclonal antibody

SKP2 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85670-4
Clone No.243080H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Cyclin-A/CDK2-associated protein p45, F box protein Skp2, F box/LRR repeat protein 1, FBL1, F-box protein Skp2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85670-4 targets SKP2 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6826

Product name: Recombinant human SKP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-344 aa of BC001441

Sequence: MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSR

Predict reactive species
Full Name S-phase kinase-associated protein 2 (p45)
Calculated Molecular Weight 48 kDa
Observed Molecular Weight48 kDa, 46 kDa
GenBank Accession NumberBC001441
Gene Symbol SKP2
Gene ID (NCBI) 6502
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13309
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SKP2(S-phase kinase-associated protein 2) is also named as FBXL1 and belongs to the F-box family. It regulates cellular proliferation by targeting several cell cycle-regulated proteins for ubiquitination and degradation, including cyclin-dependent kinase inhibitor CDKN1B(PMID:22200179). The acetylation of SKP2 in the nuclear localization signal (NLS) can promote its cytoplasmic retention, and cytoplasmic SKP2 enhances cellular migration through ubiquitination and destruction of CDH. This protein has 3 isoforms produced by alternative splicing (PMID:26497688, PMID:16902410).

Loading...
||
New chat Able
正在加载,请稍候...