SLAIN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLAIN1 Polyclonal antibody, PBS Only (22123-1-PBS)

• 

  WB analysis of HeLa using 22123-1-AP (same clone as 22123-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 22123-1-AP (SLAIN1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22123-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 22123-1-AP (same clone as 22123-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22123-1-AP (SLAIN1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22123-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 22123-1-AP (same clone as 22123-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 22123-1-AP (SLAIN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22123-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 22123-1-AP (same clone as 22123-1-PBS)

  Immunofluorescent analysis of HeLa cells using 22123-1-AP (SLAIN1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22123-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 22123-1-AP (same clone as 22123-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 22123-1-AP (SLAIN1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22123-1-PBS in a different storage buffer formulation.

SLAIN1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 22123-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

C13orf32, SLAIN motif family, member 1, SLAIN motif-containing protein 1

---

Product Information

22123-1-PBS targets SLAIN1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4973

  Product name: Recombinant human SLAIN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 60-364 aa of BC045177

  Sequence: MGYKLQDLTDVQIMARLQEESLRQDYASTSASVSRHSSSVSLSSGKKGTCSDQEYDQYSLEDEEEFDHLPPPQPRLPRCSPFQRGIPHSQTFSSIRECRRSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSTTAISSNISSPVTVRNSQSFDSSLHGAGNGISRIQSCIPSPGQLQHRVHSVGHFPVSIRQPLKATAYVSPTVQGSSNMPLSNGLQLYSNTGIPTPNKAAASGIMGRSALPRPSLAINGSNLPRSKIAQPVRSFLQPPKPLSSLSTLRDGNWRDGCY

• Full Name: SLAIN motif family, member 1
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 65-70 kDa, 34-40 kDa
• GenBank Accession Number: BC045177
• Gene Symbol: SLAIN1
• Gene ID (NCBI): 122060
• RRID: AB_2878999
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8ND83
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.