SLC19A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC19A1 Polyclonal antibody, PBS Only (25958-1-PBS)

• 

  WB analysis using 25958-1-AP (same clone as 25958-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25958-1-AP (SLC19A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 25958-1-AP (same clone as 25958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25958-1-AP (SLC19A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 25958-1-AP (same clone as 25958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25958-1-AP (SLC19A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 25958-1-AP (same clone as 25958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25958-1-AP (SLC19A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 25958-1-AP (same clone as 25958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25958-1-AP (SLC19A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25958-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC19A1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25958-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

25958-1-PBS targets SLC19A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22921

  Product name: Recombinant human SLC19A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 197-266 aa of BC003068

  Sequence: VVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSVLARMLRELGDSLRRPQ

• Full Name: solute carrier family 19 (folate transporter), member 1
• Calculated Molecular Weight: 591 aa, 65 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC003068
• Gene Symbol: SLC19A1
• Gene ID (NCBI): 6573
• RRID: AB_2880310
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41440
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC19A1, also named as RFC (reduced folate carrier), is an anionic exchanger that involved in the regulation of intracellular concentrations of folate in exchange for anions. The predicted MW of  SLC19A1 is 65 kDa and 25958-1-AP antibody recognizes the 46 kDa protein which is similar to papers. The 38-40 kDa minor forms and 58 kDa form have also been reported that could be alternate splicing, post-transcriptional modification or the role of accessory proteins. (PMID: 17404734, 9111015)