Home
Products
Primary Antibodies
SLC22A9 Polyclonal antibody, PBS Only (27998-1-PBS)

Filter: AllWBIHC

WB analysis of mouse liver using 27998-1-AP (same clone as 27998-1-PBS)
mouse liver tissue were subjected to SDS PAGE followed by western blot with 27998-1-AP (SLC22A9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27998-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 27998-1-AP (same clone as 27998-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27998-1-AP (SLC22A9 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27998-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 27998-1-AP (same clone as 27998-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27998-1-AP (SLC22A9 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27998-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 27998-1-AP (same clone as 27998-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27998-1-AP (SLC22A9 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27998-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 27998-1-AP (same clone as 27998-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27998-1-AP (SLC22A9 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27998-1-PBS in a different storage buffer formulation.

SLC22A9 Polyclonal antibody, PBS Only

Name: SLC22A9 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 27998-1-PBS

SLC22A9 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27998-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

hOAT4, OAT4, OAT7, Organic anion transporter 4, Organic anion transporter 7

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

27998-1-PBS targets SLC22A9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag27573 Product name: Recombinant human SLC22A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-175 aa of BC022379 Sequence: HILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLTSVAKFVFMAGMMVGGILGGHLSDSSRVGNT Predict reactive species
Full Name	solute carrier family 22 (organic anion transporter), member 9
Calculated Molecular Weight	553 aa, 62 kDa
Observed Molecular Weight	70 kDa
GenBank Accession Number	BC022379
Gene Symbol	SLC22A9
Gene ID (NCBI)	114571
RRID	AB_2881034
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8IVM8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.