SLC25A11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC25A11 Polyclonal antibody, PBS Only (12253-1-PBS)

• 

  WB analysis using 12253-1-AP (same clone as 12253-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12253-1-AP (SLC25A11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12253-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 12253-1-AP (same clone as 12253-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12253-1-AP (SLC25A11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12253-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 12253-1-AP (same clone as 12253-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12253-1-AP (SLC25A11 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12253-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 12253-1-AP (same clone as 12253-1-PBS)

  IP result of anti-SLC25A11 (IP:12253-1-AP, 4ug; Detection:12253-1-AP 1:1000) with HEK-293 cells lysate 1560ug. This data was developed using the same antibody clone with 12253-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 12253-1-AP (same clone as 12253-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 12253-1-AP (SLC25A11 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12253-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 12253-1-AP (same clone as 12253-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using 12253-1-AP (SLC25A11 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12253-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC25A11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12253-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

SLC20A4, OGCP, OGC, Mitochondrial 2-oxoglutarate/malate carrier protein, M2OM

---

Product Information

12253-1-PBS targets SLC25A11 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2903

  Product name: Recombinant human SLC25A11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-314 aa of BC016294

  Sequence: MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG

• Full Name: solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11
• Calculated Molecular Weight: 314 aa, 34 kDa
• Observed Molecular Weight: 28-34 kDa
• GenBank Accession Number: BC016294
• Gene Symbol: SLC25A11
• Gene ID (NCBI): 8402
• RRID: AB_2877840
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02978
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.