Product Information
21764-1-PBS targets SLC25A2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16360 Product name: Recombinant human SLC25A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC100935 Sequence: TACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQ Predict reactive species |
| Full Name | solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2 |
| Calculated Molecular Weight | 301 aa, 33 kDa |
| Observed Molecular Weight | 30-33 kDa |
| GenBank Accession Number | BC100935 |
| Gene Symbol | SLC25A2 |
| Gene ID (NCBI) | 83884 |
| RRID | AB_10858388 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BXI2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |













