SLC25A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC25A2 Polyclonal antibody, PBS Only (21764-1-PBS)

• 

  WB analysis of mouse kidney using 21764-1-AP (same clone as 21764-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21764-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 21764-1-AP (same clone as 21764-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21764-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 21764-1-AP (same clone as 21764-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21764-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21764-1-AP (same clone as 21764-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21764-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21764-1-AP (same clone as 21764-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21764-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 21764-1-AP (same clone as 21764-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21764-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 21764-1-AP (same clone as 21764-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21764-1-PBS in a different storage buffer formulation.

SLC25A2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21764-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

21764-1-PBS targets SLC25A2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16360

  Product name: Recombinant human SLC25A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-101 aa of BC100935

  Sequence: TACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQ

• Full Name: solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2
• Calculated Molecular Weight: 301 aa, 33 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC100935
• Gene Symbol: SLC25A2
• Gene ID (NCBI): 83884
• RRID: AB_10858388
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXI2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.