Use Able AI chat for product recommendations

SLC25A24 Recombinant monoclonal antibody, PBS Only (Detector)

SLC25A24 Uni-rAb® Recombinant Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA

Cat No. 86635-1-PBS
Clone No.251563C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA

APC1, MCSC1, Mitochondrial adenyl nucleotide antiporter SLC25A24, Mitochondrial ATP-Mg/Pi carrier protein 1, Mitochondrial Ca(2+)-dependent solute carrier protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86635-1-PBS targets SLC25A24 as part of a matched antibody pair:

MP02724-1: 86635-2-PBS capture and 86635-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6334

Product name: Recombinant human SLC25A24 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 128-477 aa of BC068561

Sequence: ELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK

Predict reactive species
Full Name solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Calculated Molecular Weight 53 kDa
Observed Molecular Weight48 kDa
GenBank Accession NumberBC068561
Gene Symbol SLC25A24
Gene ID (NCBI) 29957
RRIDAB_3745021
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6NUK1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SLC25A24 (solute carrier family 25 member 24) is a gene encoding a mitochondrial ATP-Mg/phosphate transporter. It belongs to the mitochondrial carrier protein family and is mainly involved in mitochondrial energy metabolism and calcium signal regulation.

Loading...
||
New chat

Able

正在加载,请稍候...