SLC25A24 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SLC25A24 Recombinant monoclonal antibody (86635-1-RR)

• 

  WB analysis using 86635-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86635-1-RR (SLC25A24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of Human Hepatocellular cancer using 86635-1-RR

  Immunohistochemical analysis of paraffin-embedded Human Hepatocellular cancer slide using 86635-1-RR (SLC25A24 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC25A24 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86635-1-RR

Clone No.251563C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

APC1, MCSC1, Mitochondrial adenyl nucleotide antiporter SLC25A24, Mitochondrial ATP-Mg/Pi carrier protein 1, Mitochondrial Ca(2+)-dependent solute carrier protein 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, BxPC-3 cells, HT-29 cells, U-251 cells, NIH/3T3 cells, mouse spleen tissue, rat spleen tissue
• Positive IHC detected in: Human Hepatocellular cancer; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86635-1-RR targets SLC25A24 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6334

  Product name: Recombinant human SLC25A24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 128-477 aa of BC068561

  Sequence: ELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK

• Full Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC068561
• Gene Symbol: SLC25A24
• Gene ID (NCBI): 29957
• RRID: AB_3745021
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6NUK1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A24 (solute carrier family 25 member 24) is a gene encoding a mitochondrial ATP-Mg/phosphate transporter. It belongs to the mitochondrial carrier protein family and is mainly involved in mitochondrial energy metabolism and calcium signal regulation.