Filter: AllWBIHC

WB analysis of RAW264.7 using 21568-1-AP (same clone as 21568-1-PBS)
RAW264.7 cells were subjected to SDS PAGE followed by western blot with 21568-1-AP (SLC25A25 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21568-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 21568-1-AP (same clone as 21568-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 21568-1-AP (SLC25A25 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21568-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 21568-1-AP (same clone as 21568-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 21568-1-AP (SLC25A25 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21568-1-PBS in a different storage buffer formulation.

SLC25A25 Polyclonal antibody, PBS Only

Name: SLC25A25 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21568-1-PBS

SLC25A25 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21568-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

21568-1-PBS targets SLC25A25 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16086 Product name: Recombinant human SLC25A25 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC103933 Sequence: MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQ Predict reactive species
Full Name	solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
Calculated Molecular Weight	469 aa, 53 kDa
Observed Molecular Weight	50 kDa, 100 kDa
GenBank Accession Number	BC103933
Gene Symbol	SLC25A25
Gene ID (NCBI)	114789
RRID	AB_10858638
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q6KCM7
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™