SLC35A5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC35A5 Polyclonal antibody, PBS Only (33755-1-PBS)

• 

  WB analysis using 33755-1-AP (same clone as 33755-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33755-1-AP (SLC35A5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33755-1-PBS in a different storage buffer formulation.

SLC35A5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33755-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Solute carrier family 35 member A5, UDP-sugar transporter protein SLC35A5, UNQ164/PRO190

---

Product Information

33755-1-PBS targets SLC35A5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8748

  Product name: Recombinant human SLC35A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 171-424 aa of BC005207

  Sequence: LQHNLAGRGFHHDAFFSPSNSCLLFRSECPRKDNCTAKEWTFPEAKWNTTARVFSHIRLGMGHVLIIVQCFISSMAIIYNEKILKEGNQLTESIFIQNSKLYFFGILFNGLTLGLQRSNRDQIKNCGFFYGHSAFSVALIFVTAFQGLSVAFILKFLDNMFHVLMAQVTTVIITTVSVLVFDFRPSLEFFLEAPSVLLSIFIYNASKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF

• Full Name: solute carrier family 35, member A5
• Calculated Molecular Weight: 424 aa, 49 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC005207
• Gene Symbol: SLC35A5
• Gene ID (NCBI): 55032
• RRID: AB_3743068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BS91
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Solute carrier family 35 member A5 (SLC35A5) is a member of the SLC35A protein subfamily comprising nucleotide sugar transporters. SLC35A5 is the sole member of the SLC35 family that contains several diacidic motifs within its cytosolically exposed C-terminus, some of which might be capable of UDP-sugar binding (PMID: 30641943).