Product Information
83085-3-PBS targets SLC35F4 in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34518 Product name: Recombinant human SLC35F4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 471-521 aa of NM_001206920 Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA Predict reactive species |
| Full Name | solute carrier family 35, member F4 |
| Calculated Molecular Weight | 521 aa, 58 kDa |
| GenBank Accession Number | NM_001206920 |
| Gene Symbol | SLC35F4 |
| Gene ID (NCBI) | 341880 |
| RRID | AB_3670801 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | A4IF30 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





