SLC35F4 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of U2OS using 83085-3-RR (same clone as 83085-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using SLC35F4 antibody (83085-3-RR, Clone: 230360B7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 83085-3-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 83085-3-RR (same clone as 83085-3-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug Anti-Human SLC35F4 (83085-3-RR, Clone:230360B7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 83085-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83085-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83085-3-RR against Human SLC35F4 were performed. The affinity constant is 0.92 nM.

SLC35F4 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83085-3-PBS

Clone No.230360B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

230360B7, C14orf36

---

Product Information

83085-3-PBS targets SLC35F4 in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34518

  Product name: Recombinant human SLC35F4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 471-521 aa of NM_001206920

  Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA

• Full Name: solute carrier family 35, member F4
• Calculated Molecular Weight: 521 aa, 58 kDa
• GenBank Accession Number: NM_001206920
• Gene Symbol: SLC35F4
• Gene ID (NCBI): 341880
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A4IF30
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.