CoraLite® Plus 488-conjugated SLC35F4 Recombinant monoclonal antibody

• 

  IF Staining of U2OS using CL488-83085-3

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CoraLite® Plus 488 SLC35F4 antibody (CL488-83085-3, Clone: 230360B7 ) at dilution of 1:200.

• 

  FC experiment of U2OS using CL488-83085-3

  1x10^6 U2OS cells were intracellularly stained with 0.8 ug CoraLite® Plus 488-conjugated SLC35F4 Recombinant antibody (CL488-83085-3, Clone:230360B7)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

SLC35F4 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-83085-3

Clone No.230360B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

230360B7, C14orf36

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells
• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83085-3 targets SLC35F4 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34518

  Product name: Recombinant human SLC35F4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 471-521 aa of NM_001206920

  Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA

• Full Name: solute carrier family 35, member F4
• Calculated Molecular Weight: 521 aa, 58 kDa
• GenBank Accession Number: NM_001206920
• Gene Symbol: SLC35F4
• Gene ID (NCBI): 341880
• RRID: AB_3673183
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A4IF30
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.