Filter: AllWBIHC

WB analysis using 24775-1-AP (same clone as 24775-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 24775-1-AP (SLC36A1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24775-1-PBS in a different storage buffer formulation.
IHC staining of human small intestine using 24775-1-AP (same clone as 24775-1-PBS)
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 24775-1-AP (SLC36A1 antibody) at dilution of 1:200 (under 0x lens). This data was developed using the same antibody clone with 24775-1-PBS in a different storage buffer formulation.
IHC staining of human small intestine using 24775-1-AP (same clone as 24775-1-PBS)
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 24775-1-AP (SLC36A1 antibody) at dilution of 1:200 (under 0x lens). This data was developed using the same antibody clone with 24775-1-PBS in a different storage buffer formulation.

SLC36A1 Polyclonal antibody, PBS Only

Name: SLC36A1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24775-1-PBS

SLC36A1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24775-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

TRAMD3, Proton-coupled amino acid transporter 1, PAT1, LYAAT1, hPAT1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

24775-1-PBS targets SLC36A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20594 Product name: Recombinant human SLC36A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC136437 Sequence: MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWF Predict reactive species
Full Name	solute carrier family 36 (proton/amino acid symporter), member 1
Calculated Molecular Weight	476 aa, 53 kDa
Observed Molecular Weight	43-53 kDa
GenBank Accession Number	BC136437
Gene Symbol	SLC36A1
Gene ID (NCBI)	206358
RRID	AB_2918086
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q7Z2H8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™