Product Information
24775-1-PBS targets SLC36A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20594 Product name: Recombinant human SLC36A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC136437 Sequence: MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWF Predict reactive species |
| Full Name | solute carrier family 36 (proton/amino acid symporter), member 1 |
| Calculated Molecular Weight | 476 aa, 53 kDa |
| Observed Molecular Weight | 43-53 kDa |
| GenBank Accession Number | BC136437 |
| Gene Symbol | SLC36A1 |
| Gene ID (NCBI) | 206358 |
| RRID | AB_2918086 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z2H8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





