SLC44A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC44A1 Polyclonal antibody, PBS Only (14687-1-PBS)

• 

  WB analysis using 14687-1-AP (same clone as 14687-1-PBS)

  HeLa lysates (heated at 100℃ and 37℃) were subjected to SDS PAGE followed by western blot with 14687-1-AP (SLC44A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14687-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 14687-1-AP (same clone as 14687-1-PBS)

  WB result of SLC44A1 antibody (14687-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC44A1 transfected HEK-293 cells. This data was developed using the same antibody clone with 14687-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC44A1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14687-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CD92, CDw92, Choline transporter-like protein 1, CHTL1, CTL1

---

Product Information

14687-1-PBS targets SLC44A1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6024

  Product name: Recombinant human SLC44A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 55-208 aa of BC049203

  Sequence: AARLVSGYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGV

• Full Name: solute carrier family 44, member 1
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 70-73 kDa
• GenBank Accession Number: BC049203
• Gene Symbol: SLC44A1
• Gene ID (NCBI): 23446
• RRID: AB_10640573
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWI5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC44A1, also referred to as choline transporter-like protein 1 (CTL1) or CDw92, is a choline transporter detected in both the plasma and mitochondrial membranes where it transports choline at high affinity and in a Na+-independent manner.