CoraLite® Plus 488-conjugated SMAD4 Recombinant monoclonal antibody

SMAD4 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-83169-5
Clone No.240026G9

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IF/ICC, FC (Intra)

MADH4, MAD homolog 4, JIP, hSMAD4, DPC4

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83169-5 targets SMAD4 in IF/ICC, FC (Intra) applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0299

Product name: Recombinant human SMAD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 13-227 aa of BC002379

Sequence: NDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPAS

Predict reactive species
Full Name SMAD family member 4
Calculated Molecular Weight 60 kDa
Observed Molecular Weight 63-70 kDa
GenBank Accession NumberBC002379
Gene Symbol SMAD4
Gene ID (NCBI) 4089
RRIDAB_3673212
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13485
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Mammalian homologs of the Drosophila Mad gene include Smad1, Smad2, Smad3, Smad4 (DPC4), Smad5, Smad6, Smad7 and Smad8. Smad1 and Smad5 are effectors of BMP2 and BMP4 function while Smad2 and Smad3 are involved in TGF and activin-mediated growth modulation. Smad4 has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/ TGF signaling by interfering with TGF-mediated phosphorylation of other Smad family members.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SMAD4 antibody CL488-83169-5Download protocol
FC protocol for CL Plus 488 SMAD4 antibody CL488-83169-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...