SMC2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84835-2-RR (same clone as 84835-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84835-2-RR (SMC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84835-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84835-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84835-2-RR against Human SMC2 were performed. The affinity constant is below 1 pM.

SMC2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84835-2-PBS

Clone No.241536E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

SMC protein 2, SMC 2, hCAP E, CAPE, CAP E

---

Product Information

84835-2-PBS targets SMC2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33471

  Product name: Recombinant human SMC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1000-1197 aa of NM_001042550.1

  Sequence: DLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPPKGAHVEV

• Full Name: structural maintenance of chromosomes 2
• Calculated Molecular Weight: 136 kDa
• Observed Molecular Weight: 135-140 kDa
• GenBank Accession Number: NM_001042550.1
• Gene Symbol: SMC2
• Gene ID (NCBI): 10592
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O95347
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMC2 is a central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases (PMID: 11136719).