SMC2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SMC2 Recombinant monoclonal antibody (84835-2-RR)

SMC2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84835-2-RR

Clone No.241536E1

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

SMC protein 2, SMC 2, hCAP E, CAPE, CAP E

• 

  WB analysis using 84835-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84835-2-RR (SMC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84835-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84835-2-RR against Human SMC2 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, Raji cells, HepG2 cells, A431 cells, HEK-293T cells, C2C12 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84835-2-RR targets SMC2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33471

  Product name: Recombinant human SMC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1000-1197 aa of NM_001042550.1

  Sequence: DLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPPKGAHVEV

• Full Name: structural maintenance of chromosomes 2
• Calculated Molecular Weight: 136 kDa
• Observed Molecular Weight: 135-140 kDa
• GenBank Accession Number: NM_001042550.1
• Gene Symbol: SMC2
• Gene ID (NCBI): 10592
• RRID: AB_3743770
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O95347
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMC2 is a central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases (PMID: 11136719).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Bioorg Chem; Millepurpan from Astragali Radix binds condensin SMC2 to reverse microglial cell cycle arrest and metabolic reprogramming in neuroinflammation.; Authors - Yue Li