SMCP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SMCP Polyclonal antibody, PBS Only (13936-1-PBS)

• 

  WB analysis using 13936-1-AP (same clone as 13936-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13936-1-AP (SMCP antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13936-1-PBS in a different storage buffer formulation.

SMCP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13936-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

MCS, MCSP, Sperm mitochondrial-associated cysteine-rich protein

---

Product Information

13936-1-PBS targets SMCP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4984

  Product name: Recombinant human SMCP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-116 aa of BC014593

  Sequence: MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK

• Full Name: sperm mitochondria-associated cysteine-rich protein
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 12-25 kDa
• GenBank Accession Number: BC014593
• Gene Symbol: SMCP
• Gene ID (NCBI): 4184
• RRID: AB_3741848
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49901
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMCP, also named as MCS and MCSP, is a cysteine- and proline-rich structural protein that is closely associated with the keratinous capsules of sperm mitochondria in the mitochondrial sheath surrounding the outer dense fibers and axoneme. It is involved in sperm motility.