Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated SMN (Human-Specific) Monoclonal antibody

SMN (Human-Specific) Monoclonal Antibody for FC (Intra)

Cat No. CL647-60154
Clone No.2C6D9

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

FC (Intra)

C BCD541, Component of gems 1, FLJ76644, Gemin 1, SMN, SMN (Human-Specific), SMN1, SMN1,SMN, SMN2, SMNC, SMNT, Survival motor neuron protein

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells
Positive FC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-60154 targets SMN (Human-Specific) in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14333

Product name: Recombinant human SMN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-282 aa of BC000908

Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA

Predict reactive species
Full Name survival of motor neuron 2, centromeric
Calculated Molecular Weight 282 aa, 30 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC000908
Gene Symbol SMN
Gene ID (NCBI) 6607
RRIDAB_2934979
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16637
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The survival of motor neurons (SMN) genes are the disease genes of spinal muscular atrophy (SMA), a common motor neuron degenerative disease. The level of SMN protein correlates with phenotypic severity of SMA. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional, because a large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein. This antibody 60154-1-Ig is specific to human SMN2. It can't recognize mouse and rat SMN.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 SMN (Human-Specific) antibody CL647-60154Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...