SMPD3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SMPD3 Polyclonal antibody, PBS Only (25613-1-PBS)

• 

  WB analysis using 25613-1-AP (same clone as 25613-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25613-1-AP (SMPD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25613-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25613-1-AP (same clone as 25613-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 25613-1-AP (SMPD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25613-1-PBS in a different storage buffer formulation.

SMPD3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25613-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:3.1.4.12, Neutral sphingomyelinase 2, Neutral sphingomyelinase II, nSMase 2, nSMase2

---

Product Information

25613-1-PBS targets SMPD3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22487

  Product name: Recombinant human SMPD3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 540-655 aa of BC112238

  Sequence: PGEEKPWAIGTLLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSSGEEEA

• Full Name: sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II)
• Calculated Molecular Weight: 655 aa, 71 kDa
• Observed Molecular Weight: 70-71 kDa
• GenBank Accession Number: BC112238
• Gene Symbol: SMPD3
• Gene ID (NCBI): 55512
• RRID: AB_3742154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY59
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMPD3 (sphingomyelin phosphodiesterase 3), also called neutral sphingomyelinase-2 (nSMase2), is a Golgi-enriched, membrane-bound Zn²⁺-dependent hydrolase that converts sphingomyelin into ceramide and phosphocholine. Ceramide functions as a bioactive lipid second messenger that integrates cellular stress, apoptosis, autophagy and differentiation signals.