SMURF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SMURF2 Polyclonal antibody, PBS Only (18038-1-PBS)

• 

  WB analysis using 18038-1-AP (same clone as 18038-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18038-1-AP (SMURF2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18038-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18038-1-AP (same clone as 18038-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18038-1-AP (SMURF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18038-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 18038-1-AP (same clone as 18038-1-PBS)

  IP result of anti-SMURF2 (IP:18038-1-AP, 4ug; Detection:18038-1-AP 1:300) with mouse testis tissue lysate 4000 ug. This data was developed using the same antibody clone with 18038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 18038-1-AP (same clone as 18038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 18038-1-AP (same clone as 18038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 18038-1-AP (same clone as 18038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 18038-1-AP (same clone as 18038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 18038-1-AP (same clone as 18038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 18038-1-AP (same clone as 18038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18038-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SMURF2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18038-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

18038-1-PBS targets SMURF2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12666

  Product name: Recombinant human SMURF2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 390-748 aa of BC093876

  Sequence: AGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE

• Full Name: SMAD specific E3 ubiquitin protein ligase 2
• Calculated Molecular Weight: 748 aa, 86 kDa
• Observed Molecular Weight: 86-100 kDa
• GenBank Accession Number: BC093876
• Gene Symbol: SMURF2
• Gene ID (NCBI): 64750
• RRID: AB_3085549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAU4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs,TGF-beta receptor,and other substrates.It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression(PMID:22231558).SMURF2 associates constitutively with SMAD7 and it is nuclear, but binding to SMAD7 induces export and recruitment to activated TGFBR, where it causes degradation of receptors and of SMAD7 via proteasomal and lysosomal pathways(PMIF:11163210). SMURF2 can be detected 100 kDa by poly-sumoylated (PMID:26679521).