SNAI2/SLUG Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82755-3-RR (same clone as 82755-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82755-3-RR (SNAI2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82755-3-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 82755-3-RR (same clone as 82755-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using SNAI2 antibody (82755-3-RR, Clone: 250290A2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82755-3-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 82755-3-RR (same clone as 82755-3-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug SNAI2/SLUG Recombinant monoclonal antibody (82755-3-RR, Clone:250290A2) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 82755-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82755-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82755-3-RR against Human SNAI2/SLUG were performed. The affinity constant is below 1 pM.

SNAI2/SLUG Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 82755-3-PBS

Clone No.250290A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

SNAI2, Protein snail homolog 2, SLUG, SLUGH, SLUGH1

---

Product Information

82755-3-PBS targets SNAI2/SLUG in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2773

  Product name: Recombinant human SNAI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-268 aa of BC015895

  Sequence: MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH

• Full Name: snail homolog 2 (Drosophila)
• Calculated Molecular Weight: 268 aa, 30 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC015895
• Gene Symbol: SLUG
• Gene ID (NCBI): 6591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43623
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SNAI2 belongs to the Snail family of zinc finger transcription factors, which shares an evolutionarily conserved role in mesoderm formation in vertebrates and invertebrates. It tiggers epithelial-mesenchymal transitions and has a crucial role in developmental processes. Also it is a transcriptional reperssor in mediating RAF-induced expression of TJ protein, occludin(OCLN) and subsequent oncogenic transformation of epithelial cells.