SNAI2/SLUG Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SNAI2/SLUG Recombinant monoclonal antibody (82755-3-RR)

SNAI2/SLUG Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 82755-3-RR

Clone No.250290A2

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

SNAI2, Protein snail homolog 2, SLUG, SLUGH, SLUGH1

• 

  WB analysis using 82755-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82755-3-RR (SNAI2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 82755-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82755-3-RR (SNAI2/SLUG antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 82755-3-RR

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 82755-3-RR (SNAI2/SLUG antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 82755-3-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using SNAI2 antibody (82755-3-RR, Clone: 250290A2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 82755-3-RR

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug SNAI2/SLUG Recombinant monoclonal antibody (82755-3-RR, Clone:250290A2) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 82755-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82755-3-RR against Human SNAI2/SLUG were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, human testis tissue, rat testis tissue, rat spleen tissue
• Positive IHC detected in: human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82755-3-RR targets SNAI2/SLUG in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2773

  Product name: Recombinant human SNAI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-268 aa of BC015895

  Sequence: MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH

• Full Name: snail homolog 2 (Drosophila)
• Calculated Molecular Weight: 268 aa, 30 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC015895
• Gene Symbol: SLUG
• Gene ID (NCBI): 6591
• RRID: AB_3743426
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43623
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNAI2 belongs to the Snail family of zinc finger transcription factors, which shares an evolutionarily conserved role in mesoderm formation in vertebrates and invertebrates. It tiggers epithelial-mesenchymal transitions and has a crucial role in developmental processes. Also it is a transcriptional reperssor in mediating RAF-induced expression of TJ protein, occludin(OCLN) and subsequent oncogenic transformation of epithelial cells.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Transl Cancer Res; PRSS1 promotes gastric cancer invasion and metastasis by induction of the epithelial-mesenchymal transition and activation of the MAPK/ERK pathway.; Authors - Xiang Bai
human	WB	Cancers (Basel); FAM64A Potentiates Bladder Carcinoma Tumorigenesis and Metastasis Through PI3K/mTORC2/AKT Pathway Activation.; Authors - Tao Zhu