CoraLite® Plus 488-conjugated SNAI2/SLUG Recombinant monoclonal antibody

• 

  IF Staining of A431 using CL488-82755-3

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 SNAI2/SLUG antibody (CL488-82755-3, Clone: 250290A2 ) at dilution of 1:200, CL594-Phalloidin (red).

SNAI2/SLUG Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82755-3

Clone No.250290A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

SNAI2, Protein snail homolog 2, SLUG, SLUGH, SLUGH1

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82755-3 targets SNAI2/SLUG in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2773

  Product name: Recombinant human SNAI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-268 aa of BC015895

  Sequence: MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH

• Full Name: snail homolog 2 (Drosophila)
• Calculated Molecular Weight: 268 aa, 30 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC015895
• Gene Symbol: SLUG
• Gene ID (NCBI): 6591
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43623
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SNAI2 belongs to the Snail family of zinc finger transcription factors, which shares an evolutionarily conserved role in mesoderm formation in vertebrates and invertebrates. It tiggers epithelial-mesenchymal transitions and has a crucial role in developmental processes. Also it is a transcriptional reperssor in mediating RAF-induced expression of TJ protein, occludin(OCLN) and subsequent oncogenic transformation of epithelial cells.