SNRPA1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85649-2-RR (same clone as 85649-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85649-2-RR (SNRPA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85649-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 85649-2-RR (same clone as 85649-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SNRPA1 antibody (85649-2-RR, Clone: 243097D9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85649-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85649-2-RR (same clone as 85649-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SNRPA1 antibody (85649-2-RR, Clone: 243097D9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85649-2-PBS in a different storage buffer formulation.

SNRPA1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85649-2-PBS

Clone No.243097D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

U2 small nuclear ribonucleoprotein A', U2 snRNP A, U2 snRNP A'

---

Product Information

85649-2-PBS targets SNRPA1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10790

  Product name: Recombinant human SNRPA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-255 aa of BC022816

  Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

• Full Name: small nuclear ribonucleoprotein polypeptide A'
• Calculated Molecular Weight: 255 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC022816
• Gene Symbol: SNRPA1
• Gene ID (NCBI): 6627
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09661
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Small nuclear ribonucleoprotein polypeptide a-prime(SNRPA1) is part of the U2 snRNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. It may be required for cell division, and helps the A' protein to bind stem loop IV of U2 snRNA. This is a rabbit polyclonal antibody raised against the full length SNRPA1 of human origin.