CoraLite® Plus 488-conjugated SNRPA1 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-85649-2

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 SNRPA1 antibody (CL488-85649-2, Clone: 243097D9 ) at dilution of 1:200, CL594-phalloidin (red).

SNRPA1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85649-2

Clone No.243097D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

U2 small nuclear ribonucleoprotein A', U2 snRNP A, U2 snRNP A'

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85649-2 targets SNRPA1 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10790

  Product name: Recombinant human SNRPA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-255 aa of BC022816

  Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

• Full Name: small nuclear ribonucleoprotein polypeptide A'
• Calculated Molecular Weight: 255 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC022816
• Gene Symbol: SNRPA1
• Gene ID (NCBI): 6627
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09661
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Small nuclear ribonucleoprotein polypeptide a-prime(SNRPA1) is part of the U2 snRNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. It may be required for cell division, and helps the A' protein to bind stem loop IV of U2 snRNA. This is a rabbit polyclonal antibody raised against the full length SNRPA1 of human origin.