SNRPB Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86099-1-RR (same clone as 86099-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86099-1-RR (SNRPB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86099-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 86099-1-RR (same clone as 86099-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using SNRPB antibody (86099-1-RR, Clone: 250577G8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86099-1-PBS in a different storage buffer formulation.

SNRPB Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86099-1-PBS

Clone No.250577G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Sm protein B/B, Sm protein B/B', Small nuclear ribonucleoprotein associated proteins B and B', Small nuclear ribonucleoprotein-associated proteins B and B', SmB/B

---

Product Information

86099-1-PBS targets SNRPB in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10298

  Product name: Recombinant human SNRPB protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-234 aa of BC003530

  Sequence: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGKCLQW

• Full Name: small nuclear ribonucleoprotein polypeptides B and B1
• Calculated Molecular Weight: 234aa,25 kDa; 285aa,30 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC003530
• Gene Symbol: SNRPB
• Gene ID (NCBI): 6628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14678
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1) is a core component of the spliceosome, a complex molecular machine that plays a critical role in pre-mRNA splicing. This process is essential for the removal of introns and the joining of exons to produce mature mRNA molecules.