SNRPF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SNRPF Polyclonal antibody (14977-1-AP)

• KD/KO Validated

SNRPF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14977-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, RIP, ELISA

Synonyms

PBSCF, Sm F, Sm protein F, SMF, Sm-F

• 

  WB analysis of human heart using 14977-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14977-1-AP

  WB result of SNRPF antibody (14977-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-SNRPF transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 14977-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14977-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 14977-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 14977-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 14977-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 14977-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 14977-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 14977-1-AP (SNRPF antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 14977-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 14977-1-AP (SNRPF antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14977-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14977-1-AP (SNRPF antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14977-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14977-1-AP (SNRPF antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14977-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SNRPF antibody (14977-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SNRPF in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human heart tissue, HepG2 cells, HeLa cells, MCF-7 cells, mouse kidney tissue, mouse liver tissue, HEK-293 cells
• Positive IHC detected in: mouse spleen tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14977-1-AP targets SNRPF in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6889

  Product name: Recombinant human SNRPF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-86 aa of BC002505

  Sequence: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

• Full Name: small nuclear ribonucleoprotein polypeptide F
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC002505
• Gene Symbol: SNRPF
• Gene ID (NCBI): 6636
• RRID: AB_2302166
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62306
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The 4 major small nuclear ribonucleoprotein particles (snRNPs), U1, U2, U4/U6, and U5, are essential components of the eukaryotic pre-mRNA splicing machinery. These snRNPs share 8 proteins which form the snRNP structural core: B/B-prime (SNRPB), D1 (SNRPD1), D2 (SNRPD2), D3 (SNRPD3), E (SNRPE), F (SNRPF), and G (SNRPG). These proteins have a role in the biogenesis of the snRNPs.

Publications

What published studies show

The SNRPF Polyclonal antibody (Cat# 14977-1-AP) has 4 citations. These appear in Molecular Cell, International Journal of Biological Macromolecules, and bioRxiv. Research fields include RNA splicing regulation in progeria (ZNF207/LMNA), PRMT5-mediated mRNA chromatin escape, and hepatocellular carcinoma progression via the cGAS-STING pathway. Applications cited are primarily Western blot, with one study also using RIP. Species studied include human and mouse.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Productive mRNA chromatin escape is promoted by PRMT5 activity; Authors - Joseph D DeAngelo
human	WB	Mol Cell; RNA-coupled CRISPR screens reveal ZNF207 as a regulator of LMNA aberrant splicing in progeria.; Authors - Amit K. Behera
mouse,human	WB,RIP	Int J Biol Macromol; Promotion of hepatocellular carcinoma by small nuclear ribonucleoprotein polypeptide F through upregulation of transmembrane P24 trafficking protein 2 and triggering of the cGAS-STING pathway.; Authors - Xiaocui Xie ; KD Validated
	WB	bioRxiv; RNA-coupled CRISPR Screens Reveal ZNF207 as a Regulator of LMNA Aberrant Splicing in Progeria; Authors - Amit K Behera