CoraLite® Plus 488-conjugated SNRPF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated SNRPF Polyclonal antibody (CL488-14977)

• 

  IF Staining of HeLa using CL488-14977

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 SNRPF antibody (CL488-14977) at dilution of 1:200.

SNRPF Polyclonal Antibody for IF/ICC

Cat No. CL488-14977

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

PBSCF, Sm F, Sm protein F, SMF, Sm-F

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14977 targets SNRPF in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6889

  Product name: Recombinant human SNRPF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-86 aa of BC002505

  Sequence: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

• Full Name: small nuclear ribonucleoprotein polypeptide F
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC002505
• Gene Symbol: SNRPF
• Gene ID (NCBI): 6636
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P62306
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The 4 major small nuclear ribonucleoprotein particles (snRNPs), U1, U2, U4/U6, and U5, are essential components of the eukaryotic pre-mRNA splicing machinery. These snRNPs share 8 proteins which form the snRNP structural core: B/B-prime (SNRPB), D1 (SNRPD1), D2 (SNRPD2), D3 (SNRPD3), E (SNRPE), F (SNRPF), and G (SNRPG). These proteins have a role in the biogenesis of the snRNPs.