SOCS6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SOCS6 Polyclonal antibody, PBS Only (27343-1-PBS)

• 

  WB analysis using 27343-1-AP (same clone as 27343-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27343-1-AP (SOCS6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27343-1-PBS in a different storage buffer formulation.

• 

  IP experiment of NIH/3T3 using 27343-1-AP (same clone as 27343-1-PBS)

  IP result of anti-SOCS6 (IP:27343-1-AP, 4ug; Detection:27343-1-AP 1:1500) with NIH/3T3 cells lysate 1200 ug. This data was developed using the same antibody clone with 27343-1-PBS in a different storage buffer formulation.

• 

  IP experiment of human placenta using 27343-1-AP (same clone as 27343-1-PBS)

  IP result of anti-SOCS6 (IP:27343-1-AP, 4ug; Detection:27343-1-AP 1:1500) with human placenta tissue lysate 960 ug. This data was developed using the same antibody clone with 27343-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 27343-1-AP (same clone as 27343-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27343-1-AP (SOCS6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27343-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 27343-1-AP (same clone as 27343-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27343-1-AP (SOCS6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27343-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 27343-1-AP (same clone as 27343-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27343-1-AP (SOCS6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27343-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 27343-1-AP (same clone as 27343-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27343-1-AP (SOCS6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27343-1-PBS in a different storage buffer formulation.

SOCS6 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 27343-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CIS 4, CIS4, CIS-4, Cytokine-inducible SH2 protein 4, HSPC060

---

Product Information

27343-1-PBS targets SOCS6 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25594

  Product name: Recombinant human SOCS6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 132-385 aa of BC020082

  Sequence: YSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWY

• Full Name: suppressor of cytokine signaling 6
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60-75 kDa
• GenBank Accession Number: BC020082
• Gene Symbol: SOCS6
• Gene ID (NCBI): 9306
• RRID: AB_3669595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14544
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SOCS6 (Suppressor of cytokine signaling 6) is also named as CIS4 and SOCS4. SOCS6 is one of eight members of the SOCS family of proteins. SOCS6 is involved in negative regulation of receptor signaling by increasing degradation mediated by ubiquitination of receptors or substrate proteins and induces apoptosis by targeting mitochondrial proteins (PMID: 25172101). SOCS6 is widely expressed in many tissues and is found to be downregulated in many cancers including colorectal cancer, gastric cancer, lung cancer, ovarian cancer, stomach cancer, thyroid cancer, hepatocellular carcinoma, and pancreatic cancer (PMID: 25172101). In addition to its molecular weight of 60 kDa, SOCS6 has a 70 kDa isoform (PMID: 34169835, PMID: 22125600).