CoraLite® Plus 488-conjugated SORBS2 Recombinant monoclonal antibody

SORBS2 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-83189-3
Clone No.240023A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Sorbin and SH3 domain-containing protein 2, ArgBP2, Arg-binding protein 2, Arg/Abl-interacting protein 2, 240023A8

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83189-3 targets SORBS2 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20041

Product name: Recombinant human SORBS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-198 aa of BC011883

Sequence: MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKHDWDPPDR

Predict reactive species
Full Name sorbin and SH3 domain containing 2
Calculated Molecular Weight 1100 aa, 124 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC011883
Gene Symbol SORBS2
Gene ID (NCBI) 8470
RRIDAB_3673218
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO94875
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SORBS2, also known as ARGBP2, has three C-terminal SH3 domains and an N-terminal sorbin homology (SoHo) domain that interacts with lipid raft proteins. SORBS2 is widely expressed in human tissues and extremely abundant in the heart. In epithelial cells SORBS2 is located in stress fibers and the nucleus; In cardiac muscle cells. SORBS2 is located in the Z-disks of sarcomeres. The subcellular localization suggests that SORBS2 functions as an adapter protein to assemble signaling complexes in stress fibers, and may influence the contractile or elastic properties of cardiac sarcomeres(PMID: 9211900). Alternate splicing results in multiple transcript variants( PMID: 28961272).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SORBS2 antibody CL488-83189-3Download protocol
IF protocol for CL Plus 488 SORBS2 antibody CL488-83189-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...